IGF-1 LR3 1mg

IGF-1 LR3 1mg is a powerful peptide designed to amplify your body’s natural growth and recovery mechanisms. It’s a game-changer for those looking to enhance muscle development, accelerate post-workout healing, and achieve peak physical performance.

Chemical Description of IGF LR3

Chemical Structure:

Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
Molar Mass: 9,111 Da
Synonyms:Long R3 IGF-1, IGF-1 LR3 (Long R3 IGF-1), LR3 IGF, IGF1 LR3, Long Arg3 IGF-1

What is IGF-1 LR3?

IGF-1 LR3, also known as Long Arg3 Insulin-like Growth Factor-I, is a modified version of insulin-like growth factor 1 (IGF-1). It has the same amino acid sequence as natural IGF-1 but with the substitution of arginine for glutamic acid at position 3 and the addition of a 13-amino acid extension peptide at the N-terminus.

These modifications make IGF-1 LR3 significantly more potent than unmodified IGF-1. The arginine substitution enhances binding affinity to IGF receptors, while the extension peptide delays degradation and clearance, prolonging its half-life and activity.

IGF-1 LR3 remains highly anabolic but has a reduced potential for side effects like hypoglycemia compared to natural IGF-1. For this reason, IGF-1 LR3 has been extensively studied for uses like boosting muscle mass, strength, and athletic performance.

Benefits Of IGF-1 LR3

Research shows IGF-1 LR3 can provide several performance- and physique-enhancing effects:

• Increases lean muscle mass and protein synthesis
• Improves nitrogen retention for muscle growth
• Reduces fat mass and increases lipolysis
• Quickens recovery between workouts
• Strengthens ligaments, tendons, and cartilage
• Has cardioprotective effects on the heart
• Enhances glycogen synthesis and endurance

Side Effects of IGF-1 LR3

Potential side effects of IGF-1 LR3 may include:

• Hypoglycemia: Can lower blood sugar?
• Water retention: can cause swelling
• Numbness or tingling: From fluid retention
• Joint pain: At higher doses
• Gynecomastia: Requires PCT
• Increased cell growth: Raises cancer risk

Proper dosing, cycle length, and post-cycle therapy are important for minimizing side effects. Those with diabetes or cancer risk may want to avoid IGF-1 LR3. As with any peptide hormone, medical guidance is advised. Check out more details about IGF-1 LR3 for bodybuilding

IGF-1 LR3 Dosage

Here are some general IGF-1 LR3 dosage guidelines:

• Men: Start at 50 mcg, up to 100 mcg daily
• Women: Start at 20–40 mcg, up to 60 mcg daily
• Injecting into muscle groups worked
• Cycle for 4–8 weeks, with extended breaks
• Use low doses to assess tolerance

Diluting the IGF-1 LR3 powder in bacteriostatic water and proper sterile injection procedures are vital for safety and results. Never exceed 100 mcg daily long-term due to the potential for serious side effects.

Buy IGF LR3 today at Enhanced Peptides

For premium-quality IGF-1 LR3 for sale, choose Enhanced Peptides. Our pharmaceutical-grade IGF-1 LR3 is independently lab-purity tested for guaranteed accurate dosing. Take advantage of our discounted bulk prices and fast discrete shipping when you buy IGF-1 LR3 online from Enhanced Peptides.