IGF-1 LR3 1mg

$56.99

IGF 1 LR3

Also known as Insulin Growth Factor 1 Long R3

IGF-1 LR3 is a single chain of polypeptides which consists of 83 amino acids. The growth factor IGF1 has many other effects which helps promoting growth and development in growth hormone(GH;MIM 139250). There is a long term analog of IGF-1 human growth factor i-e LR3, which is responsible for support of recombinant bio-pharmaceuticals manufacture at large.

Chemical Description of IGF LR3

Chemical Structure:

IGF LR3 Chemical Structure

 

Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
Molar Mass: 9,111 Da
Synonyms:Long R3 IGF-1, IGF-1 LR3 (Long R3 IGF-1), LR3 IGF, IGF1 LR3, Long Arg3 IGF-1

 

Long R3 IGF-1 is more potent than the normal factor IGF-1. The presence of biological activities in these protein bindings, cause increase in potency and increase the function of IG-1 LR3.The purpose of creation of this IGF-1 LR3 analog of IGF-1 is to increase IGF peptide in biological activities. The growth factor IGF1 LR3 is also termed as Long R3 IGF-1 or Insulin-Like Growth Factor-I Long Arg3.

The growth factor IGF-1LR3 is responsible for the cells response to growth hormone(G:H) which means that at first IGF is developed by responding to GH and then cellular movements are brought through IGF later on. Development of hyperplasia muscles growth is an example of this process. This compound is responsible for more sensitiveness of human body to insulin. This factor is the most potent and influential growth factor which human body carries. The term “Muscle Cell Hyperplasia” is the process of forming new cells as well as cell splitting by IGF 1.  IGF-1 LR3 is the strongest and effective form of IGF-1. Many chemical alterations have been applied on this formula for limiting the proteins from binding in human body and for increasing the half life up to 20-30 hour.

 

Chemical Composition of IGF 1 LR3

The actual composition of analog of IGF-1(83 amino acid) i-e Polypeptide Long R3 Insulin-Like Growth Factor-1 (IGF1 LR3), is a complete sequence of IGF-1. Although at position 3, Arginine (Arg) substitutes the Glumetic Acid (Glu) along with an extension peptide of 13 amino acid. The effect of this sequence takes place in such a way that it prohibits protein binding in IGF-1 LR3 and thus allowing it 20 to 30 hours more half life duration.

 

IGF 1 LR3 Interactions

The behavior of an active IGF differs in different types of tissues. It stimulates protein and associated cell components in muscle cells and as a result amino acid absorption occurs and protein synthesis increases. For adipose tissues, IGF-1 LR3 acts as energy source by mobilizing fat for using it as energy. It prohibits insulin from carrying glucose to cell membrane in lean tissues and furthermore making the cell to use and burn fat for energy production.

The promotional effect of IGF-1 LR3 in retention of nitrogen and protein synthesis builds new muscle tissues. Due to this effect, the muscles grow through both processes i-e Hyperplasia & Mitogenesis. Hyperlasia. The first refers increase in the number of muscle cells & and the later represents actual growth of muscle fibers. Genetic capabilities can actually change by IGF in the form of muscle tissues and cell count.

To learn more about this peptide, click here.

Buy IGF LR3 today at Enhanced Peptides

 

 

Quailty

24/7 Support

Refunds

Fast Shipping

Enhanced Peptides

Best Choice

 

 

 

 

Competitors

Worst Choice

FAQs

If you need to modify your order, please Contact Us as soon as possible. We’ll do our best to accommodate your request, but please keep in mind that we may not be able to make changes to orders that have already been shipped.

If you need to change your shipping address, please Contact Us. We’ll do our best to update your shipping information, but please keep in mind that we may not be able to make changes to orders that have already been shipped.

At this time, we do not offer same day delivery. However, we do offer fast and discreet shipping to all of our customers. Please refer to our Shipping Policy for more information on estimated delivery times.

We accept a variety of payment methods, including credit and debit cards, PayPal, and other digital payment options. You can view all of the available payment methods during the checkout process.

Sales tax may be applied to your order depending on your location and the products you are purchasing. The final price of your order, including any applicable taxes, will be displayed during the checkout process.

All prices on our website are listed in the currency of your country. If you are ordering from outside of your home country, your payment may be subject to foreign exchange fees or other charges from your bank.

If your payment is declined, please double-check that your payment information is correct and up-to-date. If the problem persists, please contact your bank or credit card company to resolve the issue. If you continue to experience issues, please contact our customer service team for assistance.

We take the security of our customers’ payment information very seriously. We do not store your payment information on our website. All transactions are processed securely using industry-standard encryption and security protocols to ensure that your information is safe and secure.

Yes, we understand that sometimes products don’t meet your expectations, and we want you to be completely satisfied with your purchase.

If you are not satisfied with your purchase, you can return it within a certain period of time for a refund or exchange.

The length of our return period varies depending on the product and the reason for the return. Generally, we offer a 30-day return policy for most products.

If you are returning a product because you changed your mind, you may be responsible for the cost of return shipping.

If the product is being returned due to a defect or error on our part, we will cover the cost of return shipping.

If you receive a product that is damaged or defective, please contact our customer service team right away. We will work with you to resolve the issue, which may include a refund, exchange, or replacement product.

Yes, we are happy to offer exchanges for products that are in new, unused condition. Please contact our customer service team to initiate an exchange.

Once we receive your returned product, we will inspect it to ensure that it meets our return policy criteria. If the product is eligible for a refund, we will process the refund within 5-7 business days.

If you receive the wrong product, please contact our customer service team right away. We will work with you to resolve the issue, which may include a refund, exchange, or replacement product.

The eligibility of an opened or used product for a return or refund varies depending on the product and the reason for the return.

Please contact our customer service team to initiate a return and discuss the eligibility of your product for a return or refund.